| Desktop | 39/100 | ✘ |
| Mobile | 13/100 | ✘ |
| Field | Data | Result |
|---|---|---|
| Page Size | 432 KB | ✘ |
| Compression | 91 KB (-79%) | ✔ |
| Text/Html Ratio | 549 / 441895 (bytes) = 0.12% | ✘ |
| Load Time | 1.41 second | ✘ |
| Mobile Ready | 0/100 | ✘ |
| In-Page Links | 14 | ✔ |
| Doc Type | HTML 5 | ✔ |
| Encoding | UTF-8 | ✔ |
| Declared Language | English | ✔ |
| Preferred Domain | Yes | ✔ |
| Robots.txt | Yes | ✔ |
| Url Rewrite | No | ✔ |
| Underscores in url | No | ✔ | Images Without ALT | 0 / 5 | ✔ |
| Embedded Objects (Desktop) | No | ✔ |
| Embedded Objects (Mobile) | Yes | ✘ |
| Iframe | Yes | ✘ |
| Custom 404 page | Yes | ✔ |
| Email Privacy | No | ✘ |
| Gsafe browsing | Yes | ✔ |
| Analytics | Yes | ✔ |
| W3C Validity | No | ✘ |
| Keywords | Freq | Title | Desc | <H> |
|---|---|---|---|---|
| wesley | 4 | ✔ | ✔ | ✔ |
| chapel | 4 | ✔ | ✔ | ✔ |
| tree | 4 | ✔ | ✔ | ✔ |
| button | 3 | ✘ | ✘ | ✘ |
| christmas | 3 | ✔ | ✔ | ✔ |
| market | 2 | ✘ | ✘ | ✔ |
| weekly | 2 | ✘ | ✘ | ✘ |
| events | 2 | ✘ | ✘ | ✔ |
| grove | 2 | ✘ | ✘ | ✘ |
| 1 | ✘ | ✘ | ✘ | |
| village | 1 | ✘ | ✘ | ✔ |
| promotions | 1 | ✘ | ✘ | ✔ |
| festivals | 1 | ✘ | ✘ | ✘ |
| morecall | 1 | ✘ | ✘ | ✘ |
| contact | 1 | ✘ | ✘ | ✘ |
|
With 1.41 seconds in page load, 432 KB of page size and all other reports below, the wesleychapelchristmastreepatch.com has a SEO score of 54 out of 100 |
| Title | Wesley Chapel Christmas Tree Patch |
| Description | Wesley Chapel's Largest Christmas Tree Patch |
| Keyword |
| Age | 0 Years, 5 Days |
| Created | 4th-Aug-2020 |
| Updated | 4th-Aug-2020 |
| Expiry | 4th-Aug-2021 |
| Host | Type | Ttl | Other |
|---|---|---|---|
| wesleychapelchristmastreepatch.com | A | 583 | ip:184.168.131.241 |
| wesleychapelchristmastreepatch.com | NS | 3600 | target:ns50.domaincontrol.com |
| wesleychapelchristmastreepatch.com | NS | 3600 | target:ns49.domaincontrol.com |
| wesleychapelchristmastreepatch.com | SOA | 3600 | mname:ns49.domaincontrol.comrname:dns.jomax.netserial:2020080600refresh:28800retry:7200expire:604800minimum-ttl:600 |
|
Domain Name: wesleychapelchristmastreepatch.com Registry Domain ID: 2550762089_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.godaddy.com Registrar URL: http://www.godaddy.com Updated Date: 2020-08-04T14:31:33Z Creation Date: 2020-08-04T14:31:33Z Registrar Registration Expiration Date: 2021-08-04T14:31:33Z Registrar: GoDaddy.com, LLC Registrar IANA ID: 146 Registrar Abuse Contact Email: abuse@godaddy.com Registrar Abuse Contact Phone: +1.4806242505 Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited Domain Status: clientUpdateProhibited http://www.icann.org/epp#clientUpdateProhibited Domain Status: clientRenewProhibited http://www.icann.org/epp#clientRenewProhibited Domain Status: clientDeleteProhibited http://www.icann.org/epp#clientDeleteProhibited Registrant Organization: Music World 28 Registrant State/Province: Florida Registrant Country: US Registrant Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=wesleychapelchristmastreepatch.com Admin Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=wesleychapelchristmastreepatch.com Tech Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=wesleychapelchristmastreepatch.com Name Server: NS49.DOMAINCONTROL.COM Name Server: NS50.DOMAINCONTROL.COM DNSSEC: unsigned URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ >>> Last update of WHOIS database: 2020-08-09T09:00:00Z |
| Server IP | 184.168.131.241 |
| Server Location | United States |
| Service Provider | GoDaddy.com, LLC |
| Domains (TLD) | Status |
|---|---|
| wesleychapelchristmastreepatch.net | Available |
| wesleychapelchristmastreepatch.org | Already Registered |
| wesleychapelchristmastreepatch.biz | Already Registered |
| wesleychapelchristmastreepatch.io | Already Registered |
| wesleychapelchristmastreepatch.info | Available |
| Domains (TLD) | Status |
|---|---|
| wesleychapelchristmastrepatch.com | Available |
| qesleychapelchristmastreepatch.com | Available |
| aesleychapelchristmastreepatch.com | Available |
| sesleychapelchristmastreepatch.com | Available |
| desleychapelchristmastreepatch.com | Available |
| Rosaleseric.com |
| Domjie.com |
| Autojet63.com |
| Strengthcoachphysiotherapy.com |
| Woodlandhillsbestafterschoolcamp.com |
| Zmemfis.com |
| Instacultuur.com |
| Lssvirtual.com |
| Fajna-fakultka.com |
| Dashandvaultgame.com |